Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rabbit CD14 Antibody (MO-AB-07515Y)


Cat: MO-AB-07515Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRabbit (Oryctolagus cuniculus)
CloneMO07515Y
SpecificityThis antibody binds to Rabbit CD14.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted; Plasma membrane; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCoreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed:1375269). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (By similarity). Binds electronegative LDL (LDL) and mediates the cytokine release induced by LDL (By similarity).
Product OverviewThis product is a mouse antibody against CD14. It can be used for CD14 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesMonocyte differentiation antigen CD14; Myeloid cell-specific leucine-rich glycoprotein; CD antigen CD14; CD14
UniProt IDQ28680
Protein RefseqThe length of the protein is 372 amino acids long. The sequence is show below: MEPVPCLLLLLLPLLRASTDTPEPCELDDDDIRCVCNFSDPQPDWSSALQCMPAVQVEMWGGGHSLEQFLRQADLYTDQRRYADVVKALRVRRLTVGAVQVPAPLLLGVLRVLGYSRLKELALEDIEVTGTAPPPPPLEATGPALSTLSLRNVSWPKGGAWLSELQQWLKPGLQVLNIAQAHTLAFSCEQVRTFSALTTLDLSENPGLGERGLVAALCPHKFPALQDLALRNAGMKTLQGVCAALAEAGVQPHHLDLSHNSLRADTQRCIWPSALNSLNLSFTGLQQVPKGLPAKLNVLDLSCNKLNRAPQPGELPKVVNLSLDGNPFLVPGASKLQEDLTNSGVFPACPPSPLAMGMSGTLALLQGARGFI.
For Research Use Only | Not For Clinical Use.

Online Inquiry