Mouse Anti-GPx4 Antibody (MO-AB-37382W)


Cat: MO-AB-37382W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-37382W Monoclonal Goat (Capra hircus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO37382W 100 µg
CBMOAB-00314FYA Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, IHC F00314FYA 100 µg
CBMOAB-44072FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO44072FYA 100 µg
CBMOAB-60124FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60124FYC 100 µg
MO-AB-07695W Monoclonal Cat (Felis catus) WB, ELISA MO07695W 100 µg
MO-AB-18189W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18189W 100 µg
MO-AB-13333R Monoclonal Cattle (Bos taurus) WB, ELISA MO13333R 100 µg
MO-AB-04046H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04046C 100 µg
MO-AB-26106H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26106C 100 µg
MO-NAB-00372W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, IHC, IHC-P NW0297 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGoat (Capra hircus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO37382W
SpecificityThis antibody binds to Goat GPx4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Goat GPx4 Antibody is a mouse antibody against GPx4. It can be used for GPx4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione peroxidase; GPx4
UniProt IDC7EXB8
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MISRWKSRLYRLLKPALLCGALAAPGLASTMCASRDDWRCARSMHEFSAKDIDGRMVNLDKYRGHVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNAEIKEFAAGYNVKFDLFSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPCYL.
For Research Use Only | Not For Clinical Use.
Online Inquiry