Mouse Anti-GPX4 Antibody (MO-AB-02216Y)
Cat: MO-AB-02216Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-02216Y | Monoclonal | Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta) | WB, ELISA | MO02216Y | 100 µg | ||
| CBMOAB-00314FYA | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IHC | F00314FYA | 100 µg | ||
| CBMOAB-44072FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44072FYA | 100 µg | ||
| CBMOAB-60124FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60124FYC | 100 µg | ||
| MO-AB-07695W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07695W | 100 µg | ||
| MO-AB-18189W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18189W | 100 µg | ||
| MO-AB-13333R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13333R | 100 µg | ||
| MO-AB-04046H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04046C | 100 µg | ||
| MO-AB-26106H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26106C | 100 µg | ||
| MO-NAB-00372W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IHC, IHC-P | NW0297 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta) |
| Clone | MO02216Y |
| Specificity | This antibody binds to Chicken GPX4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a ''moonlighting'' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3'' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization. . |
| Product Overview | This product is a mouse antibody against GPX4. It can be used for GPX4 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Glutathione peroxidase; GPX4 |
| UniProt ID | Q8QG67 |
| Protein Refseq | The length of the protein is 170 amino acids long. The sequence is show below: MCAQADEWRSATSIYDFHARDIDGRDVSLEQYRGFVCIITNVASKUGKTAVNYTQLVDLHARYAEKGLRILAFPCNQFGKQEPGDDAQIKAFAEGYGVKFDMFSKIEVNGDGAHPLWKWLKEQPKGRGTLGNAIKWNFTKFLINREGQVVKRYSPMEDPYVIEKDLPAYL. |
See other products for " GPX4 "
| CBMOAB-34191FYC | Mouse Anti-GPX4 Antibody (CBMOAB-34191FYC) |
| CBMOAB-04658HCB | Mouse Anti-GPX4 Antibody (CBMOAB-04658HCB) |
| MO-AB-37382W | Mouse Anti-GPx4 Antibody (MO-AB-37382W) |
| MO-DKB-01994W | Rabbit Anti-GPX4 Antibody (MO-DKB-01994W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry