Mouse Anti-Guinea pig CAV1 Antibody (MO-AB-41348W)


Cat: MO-AB-41348W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41348W
SpecificityThis antibody binds to Guinea pig CAV1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations; Golgi apparatus; Endosome; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.
Product OverviewMouse Anti-Guinea pig CAV1 Antibody is a mouse antibody against CAV1. It can be used for CAV1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaveolin; CAV1; Cav1
UniProt IDQ07E12
Protein RefseqThe length of the protein is178 amino acids long.
The sequence is show below: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTLFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYIHTFCDPLFEAIGKIFSNMRIAMQKEI.
For Research Use Only | Not For Clinical Use.
Online Inquiry