Mouse Anti-Guinea pig CAV1 Antibody (MO-AB-41348W)
Cat: MO-AB-41348W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Guinea pig (Cavia porcellus) |
Clone | MO41348W |
Specificity | This antibody binds to Guinea pig CAV1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Other locations; Golgi apparatus; Endosome; Endoplasmic reticulum |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1. |
Product Overview | Mouse Anti-Guinea pig CAV1 Antibody is a mouse antibody against CAV1. It can be used for CAV1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Caveolin; CAV1; Cav1 |
UniProt ID | Q07E12 |
Protein Refseq | The length of the protein is178 amino acids long. The sequence is show below: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTLFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYIHTFCDPLFEAIGKIFSNMRIAMQKEI. |
See other products for " CAV1 "
MO-AB-14467Y | Mouse Anti-Sheep CAV1 Antibody (MO-AB-14467Y) |
MO-AB-00995Y | Mouse Anti-Chicken CAV1 Antibody (MO-AB-00995Y) |
MO-AB-43914W | Mouse Anti-Horse CAV1 Antibody (MO-AB-43914W) |
CBMOAB-01096HCB | Mouse Anti-C. elegans CAV1 Antibody (CBMOAB-01096HCB) |
MO-AB-32894H | Mouse Anti-Nile tilapia cav1 Antibody (MO-AB-32894H) |
MO-AB-07450Y | Mouse Anti-Rabbit CAV1 Antibody (MO-AB-07450Y) |
MO-AB-24345R | Mouse Anti-Pig Cav1 Antibody (MO-AB-24345R) |
MOFY-0722-FY419 | Rabbit Anti-CAV1 Antibody (MOFY-0722-FY419) |
MOFY-0722-FY126 | Rabbit Anti-CAV1 Antibody (MOFY-0722-FY126) |
CBMOAB-69148FYA | Mouse Anti-Zebrafish cav1 Antibody (CBMOAB-69148FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry