Mouse Anti-Guinea pig CXCL1 Antibody (MO-AB-41495W)


Cat: MO-AB-41495W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41495W
SpecificityThis antibody binds to Guinea pig CXCL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL1 (C-X-C Motif Chemokine Ligand 1) is a Protein Coding gene. Diseases associated with CXCL1 include Kaposi Sarcoma and Melanoma. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include receptor binding and chemokine activity. An important paralog of this gene is CXCL2.
Product OverviewMouse Anti-Guinea pig CXCL1 Antibody is a mouse antibody against CXCL1. It can be used for CXCL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGrowth-regulated alpha protein; C-X-C motif chemokine 1; CXCL1; GRO SCYB1
UniProt IDO55235
Protein RefseqThe length of the protein is104 amino acids long.
The sequence is show below: MAGAAPKTLRFAPLLLLLLLLVLGTSRRAAGAPAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDPEAPMVQKVLQRMLKGSKAT.
For Research Use Only | Not For Clinical Use.
Online Inquiry