Mouse Anti-Horse CXCL1 Antibody (MO-AB-44235W)


Cat: MO-AB-44235W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44235W
SpecificityThis antibody binds to Horse CXCL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL1 (C-X-C Motif Chemokine Ligand 1) is a Protein Coding gene. Diseases associated with CXCL1 include Kaposi Sarcoma and Melanoma. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include receptor binding and chemokine activity. An important paralog of this gene is CXCL2.
Product OverviewMouse Anti-Horse CXCL1 Antibody is a mouse antibody against CXCL1. It can be used for CXCL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C motif chemokine; CXCL2
UniProt IDF6R8V8
Protein RefseqThe length of the protein is107 amino acids long.
The sequence is show below: MARAATATASCAPRLLRAALLLLLLVAATRHAAGAPVVSELRCQCLQTVQGIHLKNIQSVKVTPAGSHCAQTEVIATLKNGQETCLNPEAPMVKKMIEKMLKKGSAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry