Mouse Anti-Sheep CXCL1 Antibody (MO-AB-14781Y)


Cat: MO-AB-14781Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries)
CloneMO14781Y
SpecificityThis antibody binds to Sheep CXCL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL1 (C-X-C Motif Chemokine Ligand 1) is a Protein Coding gene. Diseases associated with CXCL1 include Kaposi Sarcoma and Melanoma. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include receptor binding and chemokine activity. An important paralog of this gene is CXCL2.
Product OverviewThis product is a mouse antibody against CXCL1. It can be used for CXCL1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C motif chemokine; NU
UniProt IDW5PZG1
Protein RefseqThe length of the protein is 75 amino acids long. The sequence is show below: AGAPVVNELRCQCLQTVQGIHLKNMQSVKVTPPGPHCGQTEVIATLKTGQEVCLNPAAPMVKKIIDKMLNQASSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry