Mouse Anti-Sheep CXCL1 Antibody (MO-AB-14781Y)
Cat: MO-AB-14781Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO14781Y |
Specificity | This antibody binds to Sheep CXCL1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CXCL1 (C-X-C Motif Chemokine Ligand 1) is a Protein Coding gene. Diseases associated with CXCL1 include Kaposi Sarcoma and Melanoma. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include receptor binding and chemokine activity. An important paralog of this gene is CXCL2. |
Product Overview | This product is a mouse antibody against CXCL1. It can be used for CXCL1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | C-X-C motif chemokine; NU |
UniProt ID | W5PZG1 |
Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: AGAPVVNELRCQCLQTVQGIHLKNMQSVKVTPPGPHCGQTEVIATLKTGQEVCLNPAAPMVKKIIDKMLNQASSN. |
See other products for " CXCL1 "
MO-AB-41495W | Mouse Anti-Guinea pig CXCL1 Antibody (MO-AB-41495W) |
MO-AB-25209H | Mouse Anti-Rat Cxcl1 Antibody (MO-AB-25209H) |
MO-AB-43055W | Mouse Anti-Hamsters CXCL1 Antibody (MO-AB-43055W) |
MO-AB-44235W | Mouse Anti-Horse CXCL1 Antibody (MO-AB-44235W) |
CBMOAB-40149FYA | Mouse Anti-Rhesus CXCL1 Antibody (CBMOAB-40149FYA) |
MO-AB-13302W | Mouse Anti-Chimpanzee CXCL1 Antibody (MO-AB-13302W) |
MO-AB-03578W | Mouse Anti-Rhesus CXCL1 Antibody (MO-AB-03578W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry