Mouse Anti-Rat Cxcl1 Antibody (MO-AB-25209H)


Cat: MO-AB-25209H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO25209C
SpecificityThis antibody binds to Rat Cxcl1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL1 (C-X-C Motif Chemokine Ligand 1) is a protein coding gene. Diseases associated with CXCL1 include Kaposi Sarcoma and Melanoma. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include receptor binding and chemokine activity. An important paralog of this gene is CXCL2.
Product OverviewThis product is a mouse antibody against Cxcl1. It can be used for Cxcl1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGrowth-regulated alpha protein; C-X-C motif chemokine 1; Cytokine-induced neutrophil chemoattractant 1; CINC-1; Platelet-derived growth factor-inducible protein KC; Cxcl1
UniProt IDP14095
Protein RefseqThe length of the protein is 96 amino acids long.
The sequence is show below: MVSATRSLLCAALPVLATSRQATGAPVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry