Mouse Anti-Guinea pig TH Antibody (MO-AB-42693W)
Cat: MO-AB-42693W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Guinea pig (Cavia porcellus) |
Clone | MO42693W |
Specificity | This antibody binds to Guinea pig TH. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Product Overview | Mouse Anti-Guinea pig TH Antibody is a mouse antibody against TH. It can be used for TH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Thyrotropin beta chain protein; TH |
UniProt ID | B7FCN0 |
Protein Refseq | The length of the protein is89 amino acids long. The sequence is show below: FASTEYTMHIDRRECAYCLTINTTICAGYCMTRDSNRKTFVSSHARFLDVCTYGDFIYKTVEIPGCPHQVAPYFSYPVAVSCKCGKCDT. |
See other products for " TH "
MO-AB-30662R | Mouse Anti-Pig TH Antibody (MO-AB-30662R) |
CBMOAB-32957FYA | Mouse Anti-D. melanogaster Th Antibody (CBMOAB-32957FYA) |
MO-AB-46795W | Mouse Anti-Horse TH Antibody (MO-AB-46795W) |
CBMOAB-60135FYA | Mouse Anti-Rhesus TH Antibody (CBMOAB-60135FYA) |
MO-DKB-00460W | Rabbit Anti-TH Antibody (MO-DKB-00460W) |
MOFY-1222-FY255 | Mouse Anti-th Antibody (MOFY-1222-FY255) |
MO-AB-66122W | Mouse Anti-Marmoset TH Antibody (MO-AB-66122W) |
MO-DKB-00134W | Rabbit Anti-th Antibody (MO-DKB-00134W) |
MO-AB-29437H | Mouse Anti-Rat Th Antibody (MO-AB-29437H) |
MO-AB-04669Y | Mouse Anti-Chicken TH Antibody (MO-AB-04669Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry