Mouse Anti-Pig TH Antibody (MO-AB-30662R)


Cat: MO-AB-30662R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO30662R
SpecificityThis antibody binds to Pig TH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTH is the rate-limiting enzyme in the synthesis of the catecholamine neurotransmitters dopamine, epinephrine and norepinephrine and is responsible for the conversion of L-tyrosine to L-dopa. The synthesis of catecholamines is regulated by the interaction of TH with its cofactor tetrahydrobiopterin (BH4) and the substrates L-tyrosine and molecular oxygen. In humans, four TH mRNA splice variants (hTH1-hTH4) have been isolated, whereas subprimate species rely on a single form of TH. The hTH1-hTH4 variants are known to have identical catalytic domains but different N-terminal regulatory domains. Importantly, LNC1 reacts with the catalytic domain of TH and thus with all four isoforms of human TH. The role of TH in the synthesis of catecholamine neurotransmitters suggests a link between this enzyme and many neuropathic diseases characterized by irregular levels of catecholamines, such as Parkinson''s disease, schizophrenia, and dystonia, as well as various cardiovascular disease.
Product OverviewThis product is a mouse antibody against TH. It can be used for TH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTyrosine hydroxylase, Fragment; TH
UniProt IDQ6XBR7
Protein RefseqThe length of the protein is 52 amino acids long.
The sequence is show below: SYASRIQRPFSVKFDPYTLAVDVLDSPHAIRRSLEGVQDELHTLAHALSAIG.
For Research Use Only | Not For Clinical Use.
Online Inquiry