Mouse Anti-Pig TH Antibody (MO-AB-30662R)
Cat: MO-AB-30662R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO30662R |
Specificity | This antibody binds to Pig TH. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | TH is the rate-limiting enzyme in the synthesis of the catecholamine neurotransmitters dopamine, epinephrine and norepinephrine and is responsible for the conversion of L-tyrosine to L-dopa. The synthesis of catecholamines is regulated by the interaction of TH with its cofactor tetrahydrobiopterin (BH4) and the substrates L-tyrosine and molecular oxygen. In humans, four TH mRNA splice variants (hTH1-hTH4) have been isolated, whereas subprimate species rely on a single form of TH. The hTH1-hTH4 variants are known to have identical catalytic domains but different N-terminal regulatory domains. Importantly, LNC1 reacts with the catalytic domain of TH and thus with all four isoforms of human TH. The role of TH in the synthesis of catecholamine neurotransmitters suggests a link between this enzyme and many neuropathic diseases characterized by irregular levels of catecholamines, such as Parkinson''s disease, schizophrenia, and dystonia, as well as various cardiovascular disease. |
Product Overview | This product is a mouse antibody against TH. It can be used for TH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tyrosine hydroxylase, Fragment; TH |
UniProt ID | Q6XBR7 |
Protein Refseq | The length of the protein is 52 amino acids long. The sequence is show below: SYASRIQRPFSVKFDPYTLAVDVLDSPHAIRRSLEGVQDELHTLAHALSAIG. |
See other products for " TH "
MO-AB-33709W | Mouse Anti-Dog TH Antibody (MO-AB-33709W) |
MOFAB-799W | Mouse Anti-TH Antibody (MOFAB-799W) |
MO-AB-21513R | Mouse Anti-Cattle TH Antibody (MO-AB-21513R) |
MO-AB-42693W | Mouse Anti-Guinea pig TH Antibody (MO-AB-42693W) |
MO-AB-08404H | Mouse Anti-Frog th Antibody (MO-AB-08404H) |
MO-AB-13427Y | Mouse Anti-O. mykiss th Antibody (MO-AB-13427Y) |
MOFY-1222-FY255 | Mouse Anti-th Antibody (MOFY-1222-FY255) |
CBMOAB-60135FYA | Mouse Anti-Rhesus TH Antibody (CBMOAB-60135FYA) |
MO-AB-29437H | Mouse Anti-Rat Th Antibody (MO-AB-29437H) |
MO-AB-04669Y | Mouse Anti-Chicken TH Antibody (MO-AB-04669Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry