Mouse Anti-Guinea pig TNF Antibody (MO-AB-42717W)
Cat: MO-AB-42717W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Guinea pig (Cavia porcellus) |
Clone | MO42717W |
Specificity | This antibody binds to Guinea pig TNF. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Extracellular region or secreted; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. |
Product Overview | Mouse Anti-Guinea pig TNF Antibody is a mouse antibody against TNF. It can be used for TNF detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a; [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2) |
UniProt ID | P51435 |
Protein Refseq | The length of the protein is234 amino acids long. The sequence is show below: MSTESMIRDVELAEEQLPKKAGGPQGSRRCWCLSLFSFLLVAGATTLFCLLHFGVIGPQREEQFSSGPPFRPLAQTLTLRSASQNDNDKPVAHVVANQQAEEELQWLSKRANALLANGMGLSDNQLVVPSDGLYLIYSQVLFKGQGCPSYLLLTHTVSRLAVSYPEKVNLLSAIKSPCQKETPEGAERKPWYEPIYLGGVFQLQKGDRLSAEVNLPQYLDFADSGQIYFGVIAL. |
See other products for " TNF "
MO-AB-38337W | Mouse Anti-Goat TNF Antibody (MO-AB-38337W) |
MO-NAB-00379W | Mouse Anti-TNF Antibody (AA 115-130) |
MO-DKB-01120W | Goat Anti-TNF Antibody (MO-DKB-01120W) |
MO-AB-21954R | Mouse Anti-Cattle TNF Antibody (MO-AB-21954R) |
MO-NAB-00208W | Rat Anti-Rhesus TNF (AA 77-233, clone NW0127) Antibody (MO-NAB-00208W) |
MO-MMB-0670 | Anti-TNF Antibody (Cat MO-MMB-0670), Mouse IgG1, kappa |
MO-AB-10256Y | Mouse Anti-Rabbit TNF Antibody (MO-AB-10256Y) |
MO-AB-33782W | Mouse Anti-Dog TNF Antibody (MO-AB-33782W) |
MO-AB-08581H | Mouse Anti-Frog tnf Antibody (MO-AB-08581H) |
MO-AB-29651H | Mouse Anti-Rat Tnf Antibody (MO-AB-29651H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry