Mouse Anti-Hamsters EIF3F Antibody (MO-AB-43111W)


Cat: MO-AB-43111W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHamsters (Cricetinae)
CloneMO43111W
SpecificityThis antibody binds to Hamsters EIF3F.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEIF3F (Eukaryotic Translation Initiation Factor 3 Subunit F) is a Protein Coding gene. Among its related pathways are Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S and Viral mRNA Translation. Gene Ontology (GO) annotations related to this gene include thiol-dependent ubiquitin-specific protease activity and translation initiation factor binding. An important paralog of this gene is PSMD7.
Product OverviewMouse Anti-Hamsters EIF3F Antibody is a mouse antibody against EIF3F. It can be used for EIF3F detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 3 subunit F; eIF3f; Eukaryotic translation initiation factor 3 subunit 5; eIF-3-epsilon; eIF3 p47; Eif3f; Eif3s5
UniProt IDA0A061IC74
Protein RefseqThe length of the protein is333 amino acids long.
The sequence is show below: MSSDSHGVQNWSPAPAQTPAPSQPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTGLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLVRNGEEQQGRAGIPVEPAGDLTVPNNGPSQSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry