Mouse Anti-Zebrafish eif3f Antibody (CBMOAB-63943FYA)


Cat: CBMOAB-63943FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63943FYA
SpecificityThis antibody binds to Zebrafish eif3f.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEIF3F (Eukaryotic Translation Initiation Factor 3 Subunit F) is a Protein Coding gene. Among its related pathways are Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S and Viral mRNA Translation. Gene Ontology (GO) annotations related to this gene include thiol-dependent ubiquitin-specific protease activity and translation initiation factor binding. An important paralog of this gene is PSMD7.
Product OverviewMouse Anti-Zebrafish eif3f Antibody is a mouse antibody against eif3f. It can be used for eif3f detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic Translation Initiation Factor 3 Subunit F; eif3f
UniProt IDR4GEX4
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: IIFYFLFEIMAVHGPVVKIHPVVLASIVDSYERRNEGASRVIGTLLGTADKHSVDVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPSEVIVGWYATGFDITEHSVLIHEYYSREAPNPIHLTVDTALQSNKMNIRAYVSSQMGVPGKTVGVMFTPLSVKYIYYDTERIGVDLLQRTRASPGRTNGLTTDLAQVAGAAGRVQEMLATVLSYIEDVLSGKVMADNSVGRFLMDLVNKVPKIPAEDFENMLNSNINDLLMVTYLANLTQAQIALNEKLVVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry