Mouse Anti-Rabbit EIF3F Antibody (MO-AB-07981Y)
Cat: MO-AB-07981Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07981Y |
Specificity | This antibody binds to Rabbit EIF3F. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. |
Product Overview | This product is a mouse antibody against EIF3F. It can be used for EIF3F detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Eukaryotic translation initiation factor 3 subunit F; eIF3f; Eukaryotic translation initiation factor 3 subunit 5; eIF-3-epsilon; eIF3 p47; EIF3F; EIF3S5 |
UniProt ID | G1SLC2 |
Protein Refseq | The length of the protein is 319 amino acids long. The sequence is show below: MATPAVSASAPPAAAAAAAGTGQTPASAQAPAQTSAPSLPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTSMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL. |
See other products for " EIF3F "
MO-AB-14098W | Mouse Anti-Chimpanzee EIF3F Antibody (MO-AB-14098W) |
MO-AB-38534W | Mouse Anti-Gorilla EIF3F Antibody (MO-AB-38534W) |
MO-AB-08118W | Mouse Anti-Cat EIF3F Antibody (MO-AB-08118W) |
MO-AB-43111W | Mouse Anti-Hamsters EIF3F Antibody (MO-AB-43111W) |
MO-AB-00416L | Mouse Anti-Elephant EIF3F Antibody (MO-AB-00416L) |
CBMOAB-41609FYA | Mouse Anti-Rhesus EIF3F Antibody (CBMOAB-41609FYA) |
MO-AB-25611H | Mouse Anti-Rat Eif3f Antibody (MO-AB-25611H) |
CBMOAB-63943FYA | Mouse Anti-Zebrafish eif3f Antibody (CBMOAB-63943FYA) |
MO-DKB-00527W | Rabbit Anti-EIF3F Antibody (MO-DKB-00527W) |
MO-AB-11296Y | Mouse Anti-O. mykiss EIF3F Antibody (MO-AB-11296Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry