Mouse Anti-Horse CASP1 Antibody (MO-AB-43905W)


Cat: MO-AB-43905W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43905W
SpecificityThis antibody binds to Horse CASP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Horse CASP1 Antibody is a mouse antibody against CASP1. It can be used for CASP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaspase-1; CASP-1; EC 3.4.22.36; Interleukin-1 beta convertase; IL-1BC; Interleukin-1 beta-converting enzyme; ICE; IL-1 beta-converting enzyme; p45; [Cleaved into: Caspase-1 subunit p20; Caspase-1 subunit p10]; CASP1; IL1BC
UniProt IDQ9TV13
Protein RefseqThe length of the protein is405 amino acids long.
The sequence is show below: MADKVLKEKRRLFIRSVGTGTVNSLLDELLEKRVLNQEEMEKVRDENATVMDKARALIDAVIRKGPQACQIFIGHICEDDPHLAETLRLSSGPQSGNFLKTQDSQAVVHSSPALQAMPDDLAKLALSGPKVSLKLCSPEVVERIWKEKSAEMYPIMGKSMTRTRLALIICNTEFDNLSRRAGAEVDIASMKVLLEGLGYSVEVKENLTALDMTTELKAFAARPEHRSSDSTFLVFMSHGIREGICGKKFSEKVPDVLEVNTIFQIFNTRNCPNLRDKPKVIIIQACRGENQGVVWLKDSTGTSGNSSSLAPDDFEDDAIKKAHVEKDFIAFCSSTPDTVSWRSPTTGSVFIEKLIENLQEYAWSCDLEEIFRKVRLSFELPDARAQMPTAERVTLTRRFYLFPGH.
For Research Use Only | Not For Clinical Use.
Online Inquiry