Mouse Anti-Horse CASP1 Antibody (MO-AB-43905W)
Cat: MO-AB-43905W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO43905W |
Specificity | This antibody binds to Horse CASP1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Cytosol; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. |
Product Overview | Mouse Anti-Horse CASP1 Antibody is a mouse antibody against CASP1. It can be used for CASP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Caspase-1; CASP-1; EC 3.4.22.36; Interleukin-1 beta convertase; IL-1BC; Interleukin-1 beta-converting enzyme; ICE; IL-1 beta-converting enzyme; p45; [Cleaved into: Caspase-1 subunit p20; Caspase-1 subunit p10]; CASP1; IL1BC |
UniProt ID | Q9TV13 |
Protein Refseq | The length of the protein is405 amino acids long. The sequence is show below: MADKVLKEKRRLFIRSVGTGTVNSLLDELLEKRVLNQEEMEKVRDENATVMDKARALIDAVIRKGPQACQIFIGHICEDDPHLAETLRLSSGPQSGNFLKTQDSQAVVHSSPALQAMPDDLAKLALSGPKVSLKLCSPEVVERIWKEKSAEMYPIMGKSMTRTRLALIICNTEFDNLSRRAGAEVDIASMKVLLEGLGYSVEVKENLTALDMTTELKAFAARPEHRSSDSTFLVFMSHGIREGICGKKFSEKVPDVLEVNTIFQIFNTRNCPNLRDKPKVIIIQACRGENQGVVWLKDSTGTSGNSSSLAPDDFEDDAIKKAHVEKDFIAFCSSTPDTVSWRSPTTGSVFIEKLIENLQEYAWSCDLEEIFRKVRLSFELPDARAQMPTAERVTLTRRFYLFPGH. |
See other products for " CASP1 "
MOFY-0722-FY281 | Rabbit Anti-CASP1 Antibody (MOFY-0722-FY281) |
MO-AB-07849W | Mouse Anti-Cat CASP1 Antibody (MO-AB-07849W) |
MO-AB-09510R | Mouse Anti-Cattle Casp1 Antibody (MO-AB-09510R) |
CBMOAB-25708FYC | Mouse Anti-Arabidopsis CASP1 Antibody (CBMOAB-25708FYC) |
MO-AB-11410W | Mouse Anti-Chimpanzee CASP1 Antibody (MO-AB-11410W) |
MO-AB-29332W | Mouse Anti-Dog CASP1 Antibody (MO-AB-29332W) |
MO-AB-07437Y | Mouse Anti-Rabbit CASP1 Antibody (MO-AB-07437Y) |
MO-DKB-00555W | Rabbit Anti-CASP1 Antibody (MO-DKB-00555W) |
MO-AB-24307R | Mouse Anti-Pig CASP1 Antibody (MO-AB-24307R) |
CBMOAB-38172FYA | Mouse Anti-Rhesus CASP1 Antibody (CBMOAB-38172FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry