Mouse Anti-Maize FEN1 Antibody (MO-AB-48132W)


Cat: MO-AB-48132W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays)
CloneMO48132W
SpecificityThis antibody binds to Maize FEN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions.
Product OverviewMouse Anti-Maize FEN1 Antibody is a mouse antibody against FEN1. It can be used for FEN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFlap endonuclease 1; FEN-1; EC 3.1.-.-; Flap structure-specific endonuclease 1; FEN1
UniProt IDB6THM0
Protein RefseqThe length of the protein is379 amino acids long.
The sequence is show below: MGIKGLTKLLADNAPKAMKEQKFESYFGRKIAVDASMSIYQFLIVVGRTGMETLTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPDMKKQELAKRYSKRDDATKDLTEAVEVGDKDAIEKLSKRTVKVTRQHNEDCKRLLRLMGVPVVEAPSEAEAECAALCINDKVFAVASEDMDSLTFGAPRXLRHLMDPSSKKIPVMEFDVAKVLEELELTMDQFIDLCILCGCDYCDSIKGIGGQTALKLIRQHGSIESILENLNKDRYQIPEDWPYQEARRLFKEPNVTLDIPELKWTAPDEEGLISFLVKDNGFNEDRVTKAIEKIKSAKNKSSQGRLESFFKPTATTSAPLKRKETSDKTSKATANKKTKAGGKKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry