Mouse Anti-Maize FEN1 Antibody (MO-AB-48132W)
Cat: MO-AB-48132W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Maize (Zea mays) |
Clone | MO48132W |
Specificity | This antibody binds to Maize FEN1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions. |
Product Overview | Mouse Anti-Maize FEN1 Antibody is a mouse antibody against FEN1. It can be used for FEN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Flap endonuclease 1; FEN-1; EC 3.1.-.-; Flap structure-specific endonuclease 1; FEN1 |
UniProt ID | B6THM0 |
Protein Refseq | The length of the protein is379 amino acids long. The sequence is show below: MGIKGLTKLLADNAPKAMKEQKFESYFGRKIAVDASMSIYQFLIVVGRTGMETLTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPDMKKQELAKRYSKRDDATKDLTEAVEVGDKDAIEKLSKRTVKVTRQHNEDCKRLLRLMGVPVVEAPSEAEAECAALCINDKVFAVASEDMDSLTFGAPRXLRHLMDPSSKKIPVMEFDVAKVLEELELTMDQFIDLCILCGCDYCDSIKGIGGQTALKLIRQHGSIESILENLNKDRYQIPEDWPYQEARRLFKEPNVTLDIPELKWTAPDEEGLISFLVKDNGFNEDRVTKAIEKIKSAKNKSSQGRLESFFKPTATTSAPLKRKETSDKTSKATANKKTKAGGKKK. |
See other products for " FEN1 "
MO-DKB-00054W | Rabbit Anti-FEN1 Antibody (MO-DKB-00054W) |
CBMOAB-76318FYA | Mouse Anti-Zebrafish fen1 Antibody (CBMOAB-76318FYA) |
MO-DKB-00055W | Rabbit Anti-FEN1 Antibody (MO-DKB-00055W) |
MO-AB-00479R | Mouse Anti-Medaka FEN1 Antibody (MO-AB-00479R) |
MO-AB-44725W | Mouse Anti-Horse FEN1 Antibody (MO-AB-44725W) |
MO-AB-08473W | Mouse Anti-Cat FEN1 Antibody (MO-AB-08473W) |
MO-AB-06475Y | Mouse Anti-O. anatinus FEN1 Antibody (MO-AB-06475Y) |
CBMOAB-16738FYA | Mouse Anti-D. melanogaster Fen1 Antibody (CBMOAB-16738FYA) |
CBMOAB-33226FYC | Mouse Anti-Arabidopsis FEN1 Antibody (CBMOAB-33226FYC) |
MO-AB-36195W | Mouse Anti-French-bean FEN1 Antibody (MO-AB-36195W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry