Mouse Anti-Marmoset MMP2 Antibody (MO-AB-59189W)


Cat: MO-AB-59189W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO59189W
SpecificityThis antibody binds to Marmoset MMP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Marmoset MMP2 Antibody is a mouse antibody against MMP2. It can be used for MMP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names72 kDa type IV collagenase isoform a preproprotein; MMP2
UniProt IDF7FMH3
Protein RefseqThe length of the protein is 660 amino acids long.
The sequence is show below: MEALKAQGALAGPLRTLCLLGCLLGHAAAPPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPNKPKWDKNQITYRILGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFSPSPGIGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFSGKEYNSCTDIGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTASYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSKDPGALMAPIYTYTKNFRLSQDDIKGIQELYGVSPDIDLGTGPTPTLGPVTPEICTQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPDLPEKIDAVYEAPQEEKTVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC.
See other products for " MMP2 "
MO-AB-08843YMouse Anti-Rabbit MMP2 Antibody (MO-AB-08843Y)
MOFY-1222-FY26Rabbit Anti-mmp2 Antibody (MOFY-1222-FY26)
MO-AB-15872RMouse Anti-Cattle MMP2 Antibody (MO-AB-15872R)
MO-AB-05230HMouse Anti-Frog mmp2 Antibody (MO-AB-05230H)
MO-AB-31896HMouse Anti-Soybean MMP2 Antibody (MO-AB-31896H)
MO-MMB-0717Anti-MMP2 Antibody (Cat MO-MMB-0717), Rabbit IgG
MO-AB-16174YMouse Anti-Sheep MMP2 Antibody (MO-AB-16174Y)
CBMOAB-24411FYAMouse Anti-D. melanogaster Mmp2 Antibody (CBMOAB-24411FYA)
CBMOAB-87120FYAMouse Anti-Zebrafish mmp2 Antibody (CBMOAB-87120FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry