Mouse Anti-Medaka AK6 Antibody (MO-AB-00038R)


Cat: MO-AB-00038R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00038R
SpecificityThis antibody binds to Medaka AK6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against AK6. It can be used for AK6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase isoenzyme 6; AK6; EC 2.7.4.3; Coilin-interacting nuclear ATPase protein; Dual activity adenylate kinase/ATPase; LOC101175487
UniProt IDH2MSF2
Protein RefseqThe length of the protein is 172 amino acids long.
The sequence is show below: MTKRPNILLTGTPGVGKTTLGKELSSRTGLTYVNVGDLAQEGQLYDGFDEDYQCPILDEDRVVDELEDKMEEGGVIVDYHGCDLFPERWFHIVFVLRTDNTQLYNRLEARGYTGKKLQDNVQCEIFQTILEEAMEAYSEDIVHQLPSNSPEDLERNLEQMSQWVEQWIKDHN.
For Research Use Only | Not For Clinical Use.
Online Inquiry