Mouse Anti-Medaka thrb Antibody (MO-AB-01754R)


Cat: MO-AB-01754R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO01754R
SpecificityThis antibody binds to Medaka thrb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Mutations in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH). Several alternatively spliced transcript variants encoding the same protein have been observed for this gene.
Product OverviewThis product is a mouse antibody against thrb. It can be used for thrb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThyroid hormone receptor beta; thrb
UniProt IDQ766D1
Protein RefseqThe length of the protein is 378 amino acids long.
The sequence is show below: MSGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLNPTYACKYEGKCVIDKVTRNQCQECRFKKCIAVGMATDLVLDDGKRLAKRKLIEENRERRRKEELQKTAWDRLEPTQEEWDLIRLVTEAHTTTNAQGSHWKQKRKFLSQAGGKETKPEDFGQSSVVSSPDGNKVDIEAFSQFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRDQLKNGGLGVVSDAIFDLGVSLSSFNLDDSEVALLQAVILLSSDRPGLSSTDRIERCQEEFLLAFEHYINHRKHKVAHFWPKLLMKVTDLRMIGACHASRFLHLKVECPTELFPPLFLEVFED.
For Research Use Only | Not For Clinical Use.
Online Inquiry