Mouse Anti-O. mykiss THRB Antibody (MO-AB-13433Y)
Cat: MO-AB-13433Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | O. mykiss (Oncorhynchus mykiss) |
Clone | MO13433Y |
Specificity | This antibody binds to O. mykiss THRB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Mutations in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH). Several alternatively spliced transcript variants encoding the same protein have been observed for this gene. |
Product Overview | This product is a mouse antibody against THRB. It can be used for THRB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Thyroid hormone receptor beta; THRB |
UniProt ID | B4XS38 |
Protein Refseq | The length of the protein is 41 amino acids long. The sequence is show below: GSKVDIEAFSQFTKIITPAITRVVDFAKKLPMFCELPCEDQ. |
See other products for " thrb "
MO-AB-01754R | Mouse Anti-Medaka thrb Antibody (MO-AB-01754R) |
MO-DKB-03921W | Goat Anti-Thrb (Center) Antibody (Cat MO-DKB-03921W) |
MO-AB-33889H | Mouse Anti-Nile tilapia THRB Antibody (MO-AB-33889H) |
MO-AB-04414Y | Mouse Anti-Chicken THRB Antibody (MO-AB-04414Y) |
CBMOAB-09373FYB | Mouse Anti-Zebrafish thrb Antibody (CBMOAB-09373FYB) |
MO-MMB-0587 | Anti-Thrb Antibody (Cat MO-MMB-0587), Goat IgG |
MO-AB-25531W | Mouse Anti-Chimpanzee THRB Antibody (MO-AB-25531W) |
CBMOAB-2738YC | Mouse Anti-E. coli thrB Antibody (CBMOAB-2738YC) |
MO-AB-66165W | Mouse Anti-Marmoset THRB Antibody (MO-AB-66165W) |
MO-DKB-03440W | Goat Anti-THRB (Center) Antibody (Cat MO-DKB-03440W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry