Mouse Anti-Pig FMR1 Antibody (MO-AB-25884R)
Cat: MO-AB-25884R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO25884R |
Specificity | This antibody binds to Pig FMR1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene binds RNA and is associated with polysomes. The encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5'' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene. [provided by RefSeq, May 2010] |
Product Overview | This product is a mouse antibody against FMR1. It can be used for FMR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fragile X mental retardation 1 protein, Fragment; FMR1 |
UniProt ID | A5PI50 |
Protein Refseq | The length of the protein is 31 amino acids long. The sequence is show below: CAKESAHKDFKKAVGAFSVTYDPEGYQLVIL. |
See other products for " FMR1 "
MO-DKB-03457W | Rabbit Anti-FMR1 Antibody (Cat MO-DKB-03457W) |
MO-AB-15881W | Mouse Anti-Chimpanzee FMR1 Antibody (MO-AB-15881W) |
CBMOAB-43027FYA | Mouse Anti-Rhesus FMR1 Antibody (CBMOAB-43027FYA) |
MO-NAB-00703W | Mouse Anti-Drosophila Fmr1 Antibody (Full length) |
MO-AB-25859H | Mouse Anti-Rat Fmr1 Antibody (MO-AB-25859H) |
MO-AB-12651R | Mouse Anti-Cattle FMR1 Antibody (MO-AB-12651R) |
MO-DKB-03649W | Rabbit Anti-FMR1 Antibody (Cat MO-DKB-03649W) |
MOFY-0922-FY91 | Mouse Anti-FMR1 Antibody, IgG1 (MOFY-0922-FY91) |
CBMOAB-16887FYA | Mouse Anti-D. melanogaster Fmr1 Antibody (CBMOAB-16887FYA) |
MO-NAB-00704W | Mouse Anti-Drosophila Fmr1 Antibody (RGG region) |
For Research Use Only | Not For Clinical Use.
Online Inquiry