Mouse Anti-Yeast IDH1 Antibody (CBMOAB-01822CR)
Cat: CBMOAB-01822CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast |
Clone | MO01822CR |
Specificity | This antibody binds to Yeast IDH1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Product Overview | Mouse Anti-Yeast IDH1 Antibody is a mouse antibody against IDH1. It can be used for IDH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial; EC 1.1.1.41; Isocitric dehydrogenase; NAD(+)-specific ICDH; IDH1; YNL037C |
UniProt ID | P28834 |
Protein Refseq | The length of the protein is 360 amino acids long. The sequence is show below: MLNRTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQTDHKEGVYEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKLSTM. |
See other products for " IDH1 "
MO-NAB-00344W | Mouse Anti-IDH1 Antibody |
MO-NAB-00176W | Mouse Anti-Rhesus IDH1 Antibody (MO-NAB-00176W) |
MO-AB-04431H | Mouse Anti-Frog idh1 Antibody (MO-AB-04431H) |
MO-AB-41844W | Mouse Anti-Guinea pig IDH1 Antibody (MO-AB-41844W) |
MO-AB-57103W | Mouse Anti-Marmoset IDH1 Antibody (MO-AB-57103W) |
CBMOAB-05230HCB | Mouse Anti-C. elegans IDH1 Antibody (CBMOAB-05230HCB) |
MOFAB-522W | Mouse Anti-Zebrafish idh1 Antibody (MOFAB-522W) |
MO-AB-15701Y | Mouse Anti-Sheep IDH1 Antibody (MO-AB-15701Y) |
MO-AB-26463R | Mouse Anti-Pig IDH1 Antibody (MO-AB-26463R) |
MO-AB-13940R | Mouse Anti-Cattle IDH1 Antibody (MO-AB-13940R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry