Mouse Anti-Zebrafish npc1 Antibody (CBMOAB-89707FYA)


Cat: CBMOAB-89707FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO89707FYA
SpecificityThis antibody binds to Zebrafish npc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a large protein that resides in the limiting membrane of endosomes and lysosomes and mediates intracellular cholesterol trafficking via binding of cholesterol to its N-terminal domain. It is predicted to have a cytoplasmic C-terminus, 13 transmembrane domains, and 3 large loops in the lumen of the endosome - the last loop being at the N-terminus. This protein transports low-density lipoproteins to late endosomal/lysosomal compartments where they are hydrolized and released as free cholesterol. Defects in this gene cause Niemann-Pick type C disease, a rare autosomal recessive neurodegenerative disorder characterized by over accumulation of cholesterol and glycosphingolipids in late endosomal/lysosomal compartments.
Product OverviewMouse Anti-Zebrafish npc1 Antibody is a mouse antibody against npc1. It can be used for npc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNiemann-Pick disease type C1 protein; npc1; NPC
UniProt IDF6N6I8
Protein RefseqThe length of the protein is 1277 amino acids long.
The sequence is show below: MLLLGRNHIFRLLLATVLLSHWVHGQHCIWYGECGNSPNVPEKKLNCNYTGPAVPLPNEGQELLQELCPRLVYADNRVCCDTQQLNTLKSNIQIPLQYLSRCPACFFNFMTLFCELTCSPRQSQFISVKDFLKEKNLTSVGNVTYYITQTFADAMFNACRDVQAPSSNIKALGLLCGRDASVCTPQIWIQYMFSISNGQVPFGIEPIFTDVPVQGMTPMNNRTFNCSQSLDDGSEPCSCQDCSEVCGPTPVPPPIPPPWIILGLDAMSFIMWCSYIAFLLIFFGVVLGAWCYRRSVVTXEYGPILDSNQPHSLNSDGTDLIDEASCCETVGERFENSLRLVFSRWGSLCVRQPLTIILSSLVLICICSAGLSYMRITTNPVELWSAPSSRARQEKNCFDQHFGPFFRTEQLIITTPWTEEGGFSTITGDIIPFSPILNLSLLHQVLDLQLEIENLIAEYKGENVTLKDICVSPLSPYNDNCTILSVLNYFQNSHEVLDHEFQDEFFLYNDYHTHLLYCASSPTSLDDTSRLHDPCMGTFGGPVFPWLVLGGYEDSAYNNATALFFTFPVTNCLNDTEKLGKALAWEKEFIRFMKNYENPNLTVSFSSERSIEDEIDRESNSDVSTIVISYIIMFVYISVALGRINSCRTLLVDSKISLGIAGILIVLSSVACSLGIFSYIGIPLTLIVIEVIPFLVLAVGVDNIFIIVQTYQRDERMPEEELHQQIGRILGDVAPSMFLSSFSETVAFFLGALSTMPAVRTFSLFAGLAIFIDFLLQISCFVSLLGLDIKRQEANRMDILCCVKLSDGQEEKSEGWLFRFFKKIYAPFILKDWVRPLVVAVFVGMLSFSIAVVNKVEIGLEQTLSMPDDSYVLNYFGNLSKYLHTGPPVYFVVEDGHDYKTFEGQNAVCGGVGCNNDSLVQQIYTASLMSNYTRISNVPSSWLDDYFDWVKPQSTCCRYYNSTGAFCNASVVDKSCVHCRPMTSSGKQRPNGTEFMHFLPMFLSDNPNIKCGKGGHAAYGTAVDLKDNNTDVGATYFMSYHTILKNSSDFINAMKMARELTDNITQTLSTHDKSYKVFPYSVFYVFYEQYLTIVDDTALNLGVSLSAIFIVTAVLLGFELWSAVLVCFTIAMILINMFGVMWLWSISLNAVSLVNLVMSCGISVEFCSHIVRAFSISTRSSRVERAEEALAHMGSSVFSGITLTKFGGILILALSKSQIFQIFYFRMYLAIVLLGAAHGLIFLPVLLSYAGKSLSPRTFMICLEAVVHLKHLKTRHH.
For Research Use Only | Not For Clinical Use.
Online Inquiry