Mouse Anti-Zebrafish ptprc Antibody (CBMOAB-94617FYA)


Cat: CBMOAB-94617FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO94617FYA
SpecificityThis antibody binds to Zebrafish ptprc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein product of this gene, best known as CD45, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family.
Product OverviewMouse Anti-Zebrafish ptprc Antibody is a mouse antibody against ptprc. It can be used for ptprc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesptprc; protein tyrosine phosphatase receptor type C
UniProt IDQ1LX95
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MARFFAIGPLVLVLCLVLLSSGESYAGTGTTENQEKCRYNIIWNENEAIINVSSINDKTSDHKNQKYRIELKQNNETISNGRSPLTIPLKKVEPCTNYTIHVDNCSLQEKNSFHFNATESKIHTAKLHGDDQVCVEDGTWNLTKCVNIETKDSCLQSPIVFIQSECTYTIKIHMPPLKPEIQYNETIPTKFVWENKPKECNESNFNVHCDKEISGFKVNQDVYLIPSKKYNCIGKYEFNDTISESNNTEITISCG.
For Research Use Only | Not For Clinical Use.
Online Inquiry