Mouse Anti-Cattle CD3E Antibody (MO-AB-09825R)


Cat: MO-AB-09825R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09825R
SpecificityThis antibody binds to Cattle CD3E.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPart of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Product OverviewMouse Anti-Cattle CD3E Antibody is a mouse antibody against CD3E. It can be used for CD3E detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD3 epsilon chain; CD antigen CD3e; CD3E
UniProt IDQ28073
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MQSGNLWRALGLCLLLVGAWAQDADEQKPYEVSISGNTVELTCPREFEGEIHWKQNDEQMKGYTGKQLLLENFSEMDNSGYYQCYMTEGNKEAAHTLYLKARVCQNCMEVNLMEVATIIVVDICVTLGLLLLVYYWSKSRKAKASPMTRGAGAGGRPRGQNKGRPPPVPNPDYEPIRKGQRDLYAGLNQRGV.

Reference

ReferenceLi, L., Teale, A., Bensaid, A., Dunlap, S., Dietz, A. B., & Womack, J. E. (1992). Somatic cell mapping of T-cell receptor CD3 complex and CD8 genes in cattle. Immunogenetics, 36, 224-229.
See other products for " CD3E "
MO-AB-07526YMouse Anti-Rabbit CD3E Antibody (MO-AB-07526Y)
MO-AB-08896WMouse Anti-Cat CD3E Antibody (MO-AB-08896W)
MO-AB-29466WMouse Anti-Dog CD3E Antibody (MO-AB-29466W)
MO-AB-01057YMouse Anti-Chicken CD3E Antibody (MO-AB-01057Y)
MOFY-0522-FY51Mouse Anti-CD3E Antibody (MOFY-0522-FY51)
MO-AB-24637HMouse Anti-Rat Cd3e Antibody (MO-AB-24637H)
MO-AB-24453RMouse Anti-Pig CD3E Antibody (MO-AB-24453R)
MOFY-0522-FY59Mouse Anti-CD3E Antibody (MOFY-0522-FY59)
MO-AB-14497YMouse Anti-Sheep CD3E Antibody (MO-AB-14497Y)
MO-AB-34518WMouse Anti-Ferret CD3e Antibody (MO-AB-34518W)
For Research Use Only | Not For Clinical Use.
Online Inquiry