Mouse Anti-Pig CD3E Antibody (MO-AB-24453R)


Cat: MO-AB-24453R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24453R
SpecificityThis antibody binds to Pig CD3E.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD3E (CD3e Molecule) is a Protein Coding gene. Diseases associated with CD3E include Immunodeficiency 18 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta/Cd3epsilon/Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and signal transducer activity.
Product OverviewThis product is a mouse antibody against CD3E. It can be used for CD3E detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD3 epsilon chain; CD3E
UniProt IDF1SAK8
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MPSGNLWKVLGLCLLSVGAWGQEDIERPDEDTQKTFKVSISGDKVELTCPEDPESEKMTWKRNDMQIYESYDNYMLLESFSEVENSGYYTCTVGEKTSHRLYLKARVCENCVEVDLMAVVTIIVVDICITLGLLMVVYYYSKSRKAKAMPVTRGAGAGGRPRGQNRERPPPVPNPDYEPIRKGQRDLYAGLNQRGR.

Reference

Reference1. Li, J., Zhong, Y., Li, H., Zhang, N., Ma, W., Cheng, G., ... & Xu, J. (2011). Enhancement of Astragalus polysaccharide on the immune responses in pigs inoculated with foot-and-mouth disease virus vaccine. International Journal of Biological Macromolecules, 49(3), 362-368.
2. Kirkham, P. A., Takamatsu, H., Yang, H., & Parkhouse, R. M. E. (1996). Porcine CD3ε: its characterization, expression and involvement in activation of porcine T lymphocytes. Immunology, 87(4), 616-623.
See other products for " CD3E "
MO-AB-01057YMouse Anti-Chicken CD3E Antibody (MO-AB-01057Y)
MO-AB-08896WMouse Anti-Cat CD3E Antibody (MO-AB-08896W)
MO-AB-34518WMouse Anti-Ferret CD3e Antibody (MO-AB-34518W)
MOFY-0522-FY51Mouse Anti-CD3E Antibody (MOFY-0522-FY51)
MO-AB-24637HMouse Anti-Rat Cd3e Antibody (MO-AB-24637H)
MO-AB-29466WMouse Anti-Dog CD3E Antibody (MO-AB-29466W)
MO-AB-07526YMouse Anti-Rabbit CD3E Antibody (MO-AB-07526Y)
CBMOAB-38700FYAMouse Anti-Rhesus CD3E Antibody (CBMOAB-38700FYA)
MOFY-0522-FY59Mouse Anti-CD3E Antibody (MOFY-0522-FY59)
MO-AB-14497YMouse Anti-Sheep CD3E Antibody (MO-AB-14497Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry