Mouse Anti-Rat Cd3e Antibody (MO-AB-24637H)


Cat: MO-AB-24637H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24637C
SpecificityThis antibody binds to Rat Cd3e.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD3E (CD3e Molecule) is a protein coding gene. Diseases associated with CD3E include Immunodeficiency 18 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta/Cd3epsilon/Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and signal transducer activity.
Product OverviewThis product is a mouse antibody against Cd3e. It can be used for Cd3e detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD3 antigen, epsilon polypeptide; Protein Cd3e; Cd3e
UniProt IDD4A5M2
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: MQWNAFWSILGLSLLAVGTCQEEYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLYLKARVCENCMEVDLTAVSIIIIVDICITLGLLMVVYYWSKKRKAKAKPVTRGTGTGGRPRGKAQGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV.

Reference

ReferenceRidge, K., Downes, N., & Finney, B. (2019). Effects of strain, sex and age on immunophenotyping parameters in the rat and mouse. Comparative Clinical Pathology, 28(1), 41-51.
For Research Use Only | Not For Clinical Use.
Online Inquiry