Mouse Anti-Rabbit CD3E Antibody (MO-AB-07526Y)
Cat: MO-AB-07526Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07526Y |
Specificity | This antibody binds to Rabbit CD3E. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region. |
Product Overview | This product is a mouse antibody against CD3E. It can be used for CD3E detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | T-cell surface glycoprotein CD3 epsilon chain; CD antigen CD3e; CD3E |
UniProt ID | Q9TUF9 |
Protein Refseq | The length of the protein is 198 amino acids long. The sequence is show below: MRAGTLWRVLALWLLSVAAWGQEDDDHADDYTQKLFTVSISGTRVVLTCPVEAEGGDIHWERDEKSLPNTKKELDLTDFSEMEHSGYYSCYVGTKNKENEHILYLKARVCEACMEVDLTTVASIVVADVCVTLGLLLLVYYWSKNRKAKCKPVTRGAGAGGRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRGI. |
See other products for " CD3e "
MO-AB-34518W | Mouse Anti-Ferret CD3e Antibody (MO-AB-34518W) |
CBMOAB-38700FYA | Mouse Anti-Rhesus CD3E Antibody (CBMOAB-38700FYA) |
MOFY-0522-FY51 | Mouse Anti-CD3E Antibody (MOFY-0522-FY51) |
MO-AB-24637H | Mouse Anti-Rat Cd3e Antibody (MO-AB-24637H) |
MOFY-0522-FY59 | Mouse Anti-CD3E Antibody (MOFY-0522-FY59) |
MO-AB-01057Y | Mouse Anti-Chicken CD3E Antibody (MO-AB-01057Y) |
MO-AB-24453R | Mouse Anti-Pig CD3E Antibody (MO-AB-24453R) |
MO-AB-08896W | Mouse Anti-Cat CD3E Antibody (MO-AB-08896W) |
MO-AB-29466W | Mouse Anti-Dog CD3E Antibody (MO-AB-29466W) |
MO-AB-14497Y | Mouse Anti-Sheep CD3E Antibody (MO-AB-14497Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry