Mouse Anti-Dog CD3E Antibody (MO-AB-29466W)


Cat: MO-AB-29466W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29466W
SpecificityThis antibody binds to Dog CD3E.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD3E (CD3e Molecule) is a Protein Coding gene. Diseases associated with CD3E include Immunodeficiency 18 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta/Cd3epsilon/Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and signal transducer activity.
Product OverviewMouse Anti-Dog CD3E Antibody is a mouse antibody against CD3E. It can be used for CD3E detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD3 epsilon chain; CD antigen CD3e; CD3E
UniProt IDP27597
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MQSRNLWRILGLCLLSVGAWGQDEDFKASDDLTSISPEKRFKVSISGTEVVVTCPDVFGYDNIKWEKNDNLVEGASNRELSQKEFSEVDDSGYYACYADSIKEKSYLYLRARVCANCIEVNLMAVVTIIVADICLTLGLLLMVYYWSKTRKANAKPVMRGTGAGSRPRGQNKEKPPPVPNPDYEPIRKGQQDLYSGLNQRGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry