Mouse Anti-Cattle D2HGDH Antibody (MO-AB-11161R)


Cat: MO-AB-11161R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11161R
SpecificityThis antibody binds to Cattle D2HGDH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes D-2hydroxyglutarate dehydrogenase, a mitochondrial enzyme belonging to the FAD-binding oxidoreductase / transferase type 4 family. This enzyme, which is most active in liver and kidney but also active in heart and brain, converts D-2-hydroxyglutarate to 2-ketoglutarate. Mutations in this gene are present in D-2-hydroxyglutaric aciduria, a rare recessive neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features.D2HGDH (D-2-Hydroxyglutarate Dehydrogenase) is a Protein Coding gene. Diseases associated with D2HGDH include D-2-Hydroxyglutaric Aciduria 1 and 2-Hydroxyglutaric Aciduria. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Pyruvate metabolism and Citric Acid (TCA) cycle. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and oxidoreductase activity, acting on CH-OH group of donors.Catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.
Product OverviewMouse Anti-Cattle D2HGDH Antibody is a mouse antibody against D2HGDH. It can be used for D2HGDH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesD-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.-; D2HGDH
UniProt IDQ1JPD3
Protein RefseqThe length of the protein is 544 amino acids long.
The sequence is show below: MMMPRLVPRWPAWLFCWRAACIQGASVRQKMWAGPSKIPGLGGPRGAWGTSPLVPRGSCSASSRTPEVTLTPERYPVQRLPFSVVSEDDLAALERVVPGRVITDPEELEPPNVDWLRTVRGSSKVLLRPRTTQEVAHILRYCHERNLAVNPQGGNTGMVGGSTPVFDEIILSTALMNQVLSFHDVSGVLVCQAGCVLEALSQYVEERGFIMPLDLGAKGSCHIGGNVATNAGGLRVLRYGSLRGTVLGLEVVLAD.
For Research Use Only | Not For Clinical Use.
Online Inquiry