Mouse Anti-Cattle FOS Antibody (MO-AB-12673R)


Cat: MO-AB-12673R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12673R
SpecificityThis antibody binds to Cattle FOS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Nucleus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIn the field of molecular biology and genetics, c-Fos is a proto-oncogene and a homolog of the human retroviral oncogene v-fos. It was first discovered in rat fibroblasts, and it is a transformed gene of FBJ MSV (Finkel-Biskis-Kingsins murine osteosarcoma virus) (Curran and Tech, 1982). It is part of a larger family of Fos transcription factors, including c-Fos, FosB, Fra-1 and Fra-2. It has been mapped to chromosome region 14q21→q31. c-Fos encodes a 62 kDa protein that forms a heterodimer with c-jun (part of the transcription factor Jun family), resulting in the formation of an AP-1 (activator protein-1) complex, which is located in AP- 1 Specific sites bind DNA in the promoter and enhancer regions of target genes, and convert extracellular signals into changes in gene expression. It plays an important role in many cell functions and has been found to be overexpressed in many cancers.
Product OverviewMouse Anti-Cattle FOS Antibody is a mouse antibody against FOS. It can be used for FOS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProto-oncogene c-Fos; Cellular oncogene fos; FOS
UniProt IDO77628
Protein RefseqThe length of the protein is 380 amino acids long.
The sequence is show below: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFTLPLLNDPEPKPSVEP.
See other products for " FOS "
MO-NAB-00322WMouse Anti-FOS Antibody
MO-AB-08763WMouse Anti-Cat FOS Antibody (MO-AB-08763W)
MO-AB-15293YMouse Anti-Sheep FOS Antibody (MO-AB-15293Y)
MO-AB-03664HMouse Anti-Frog fos Antibody (MO-AB-03664H)
MO-AB-55602WMouse Anti-Marmoset FOS Antibody (MO-AB-55602W)
MO-AB-25877HMouse Anti-Rat Fos Antibody (MO-AB-25877H)
MOFY-1222-FY61Rabbit Anti-fos Antibody (MOFY-1222-FY61)
MO-AB-43144WMouse Anti-Hamsters FOS Antibody (MO-AB-43144W)
MO-AB-20534WMouse Anti-Chimpanzee FOS Antibody (MO-AB-20534W)
CBMOAB-76762FYAMouse Anti-Zebrafish fos Antibody (CBMOAB-76762FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry