Mouse Anti-Rat Fos Antibody (MO-AB-25877H)
Cat: MO-AB-25877H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO25877C |
Specificity | This antibody binds to Rat Fos. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. |
Product Overview | This product is a mouse antibody against Fos. It can be used for Fos detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Proto-oncogene c-FOS; Fos |
UniProt ID | Q5U874 |
Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: DFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRAQSIGRRGKVEQ. |
See other products for " FOS "
MO-AB-20534W | Mouse Anti-Chimpanzee FOS Antibody (MO-AB-20534W) |
MO-AB-08763W | Mouse Anti-Cat FOS Antibody (MO-AB-08763W) |
MO-NAB-00322W | Mouse Anti-FOS Antibody |
MOFY-1222-FY61 | Rabbit Anti-fos Antibody (MOFY-1222-FY61) |
MO-AB-55602W | Mouse Anti-Marmoset FOS Antibody (MO-AB-55602W) |
MO-AB-43144W | Mouse Anti-Hamsters FOS Antibody (MO-AB-43144W) |
CBMOAB-76762FYA | Mouse Anti-Zebrafish fos Antibody (CBMOAB-76762FYA) |
MO-AB-15293Y | Mouse Anti-Sheep FOS Antibody (MO-AB-15293Y) |
MO-AB-03664H | Mouse Anti-Frog fos Antibody (MO-AB-03664H) |
MO-AB-12673R | Mouse Anti-Cattle FOS Antibody (MO-AB-12673R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry