Mouse Anti-Chimpanzee FOS Antibody (MO-AB-20534W)


Cat: MO-AB-20534W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO20534W
SpecificityThis antibody binds to Chimpanzee FOS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
Product OverviewMouse Anti-Chimpanzee FOS Antibody is a mouse antibody against FOS. It can be used for FOS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-fos; FBJ murine osteosarcoma viral oncogene homolog; FOS
UniProt IDA5A6H0
Protein RefseqThe length of the protein is 380 amino acids long.
The sequence is show below: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL.
See other products for " fos "
CBMOAB-76762FYAMouse Anti-Zebrafish fos Antibody (CBMOAB-76762FYA)
MO-AB-55602WMouse Anti-Marmoset FOS Antibody (MO-AB-55602W)
MO-AB-15293YMouse Anti-Sheep FOS Antibody (MO-AB-15293Y)
MOFY-1222-FY61Rabbit Anti-fos Antibody (MOFY-1222-FY61)
MO-AB-25877HMouse Anti-Rat Fos Antibody (MO-AB-25877H)
MO-AB-08763WMouse Anti-Cat FOS Antibody (MO-AB-08763W)
MO-AB-43144WMouse Anti-Hamsters FOS Antibody (MO-AB-43144W)
MO-AB-03664HMouse Anti-Frog fos Antibody (MO-AB-03664H)
MO-AB-12673RMouse Anti-Cattle FOS Antibody (MO-AB-12673R)
MO-NAB-00322WMouse Anti-FOS Antibody
For Research Use Only | Not For Clinical Use.
Online Inquiry