Mouse Anti-Cattle NCSTN Antibody (MO-AB-16445R)


Cat: MO-AB-16445R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16445R
SpecificityThis antibody binds to Cattle NCSTN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Plasma membrane; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may be a stabilizing cofactor required for gamma-secretase complex assembly. The cleavage of beta-amyloid precursor protein yields amyloid beta peptide, the main component of the neuritic plaque and the hallmark lesion in the brains of patients with Alzheimer''s disease; however, the nature of the encoded protein''s role in Alzheimer''s disease is not known for certain. Mutations in this gene are associated with familial acne inversa. A pseudogene of this gene is present on chromosome 21. Alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Feb 2014]
Product OverviewMouse Anti-Cattle NCSTN Antibody is a mouse antibody against NCSTN. It can be used for NCSTN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNicastrin; NCSTN
UniProt IDQ3SZQ1
Protein RefseqThe length of the protein is 717 amino acids long.
The sequence is show below: MATAGGGCVADPGSRSLLRLLSFCVLLAGLCEGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYVVLLEGTLFTRDVMEKLKGRSGRIAGLAVSLAKPSPASGFSPSVQCPNDGFGVYSNSYGSQFAHCRAFQWNKVGDGLAYEDFSFPIFLLEDENETNVIKQCYRDHNLSPNGSAPAFPLCAMQLFSHMHAVVSTVTCMRRSLIQSSFSISPEIVCDPLSDYN.
For Research Use Only | Not For Clinical Use.
Online Inquiry