Connect with Us at the Upcoming Events

With in-person events back again, Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at 2022 BIO International Convention in June (booth #1754) and at the 13th Annual World ADC San Diego in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Medaka IL-17A Antibody (MO-AB-00751R)


Cat: MO-AB-00751R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00751R
SpecificityThis antibody binds to Medaka IL-17A.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against IL-17A. It can be used for IL-17A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-17A/F-3; IL-17A/F-3
UniProt IDE3WEA9
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: MLLVLRALLLLGLLSLEHAKKSQTFPARLKQGPKYRTLKVSLDPSVMPQFYSVSTSNLANSSLSPWTYRENYNSSRLPKSISEAECQTSGCIRDGVEDDALEAKPIQYQILVLYRVQKQQSVGKKKKKKSRKYDFMLGTQVITVGCTCVRPSVITQQ.
For Research Use Only | Not For Clinical Use.

Online Inquiry