Mouse Anti-Rhesus GCH1 Antibody (CBMOAB-43465FYA)
Cat: CBMOAB-43465FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO43465FYA |
Specificity | This antibody binds to Rhesus GCH1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme. |
Product Overview | Mouse Anti-Rhesus GCH1 Antibody is a mouse antibody against GCH1. It can be used for GCH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GCH1 |
UniProt ID | F7BUQ5 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: MQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARSAEP. |
See other products for " GCH1 "
MO-AB-02045Y | Mouse Anti-Chicken GCH1 Antibody (MO-AB-02045Y) |
MO-AB-55907W | Mouse Anti-Marmoset GCH1 Antibody (MO-AB-55907W) |
MO-AB-16160W | Mouse Anti-Chimpanzee GCH1 Antibody (MO-AB-16160W) |
MO-AB-25964H | Mouse Anti-Rat Gch1 Antibody (MO-AB-25964H) |
CBMOAB-33899FYC | Mouse Anti-Arabidopsis GCH1 Antibody (CBMOAB-33899FYC) |
CBMOAB-77680FYA | Mouse Anti-Zebrafish gch1 Antibody (CBMOAB-77680FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry