Mouse Anti-Rhesus GPX4 Antibody (CBMOAB-60124FYC)
Cat: CBMOAB-60124FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO60124FYC |
Specificity | This antibody binds to Rhesus GPX4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization. . |
Product Overview | Mouse Anti-Rhesus GPX4 Antibody is a mouse antibody against GPX4. It can be used for GPX4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform C; GPX4 |
UniProt ID | I2CYL1 |
Protein Refseq | The length of the protein is 109 amino acids long. The sequence is show below: MGRAGAGSPRRRRQRCQSRGRRRPRAPRRRKAPACRRRRARRRRKEPCPRSLGPEIHECPESQDPCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ. |
See other products for " GPX4 "
MO-NAB-00372W | Rabbit Anti-GPX4 Antibody (AA 30-70) |
MO-AB-26106H | Mouse Anti-Rat Gpx4 Antibody (MO-AB-26106H) |
MO-AB-07695W | Mouse Anti-Cat GPX4 Antibody (MO-AB-07695W) |
MO-AB-18189W | Mouse Anti-Chimpanzee GPX4 Antibody (MO-AB-18189W) |
CBMOAB-44072FYA | Mouse Anti-Rhesus GPX4 Antibody (CBMOAB-44072FYA) |
CBMOAB-00314FYA | Rabbit Anti-Mouse GPX4 Antibody (CBMOAB-00314FYA) |
MO-AB-13333R | Mouse Anti-Cattle GPX4 Antibody (MO-AB-13333R) |
MO-AB-02216Y | Mouse Anti-Chicken GPX4 Antibody (MO-AB-02216Y) |
MO-AB-37382W | Mouse Anti-Goat GPx4 Antibody (MO-AB-37382W) |
CBMOAB-04658HCB | Mouse Anti-C. elegans GPX4 Antibody (CBMOAB-04658HCB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry