Mouse Anti-Cat CASP3 Antibody (MO-AB-08320W)


Cat: MO-AB-08320W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08320W
SpecificityThis antibody binds to Cat CASP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.
Product OverviewMouse Anti-Cat CASP3 Antibody is a mouse antibody against CASP3. It can be used for CASP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCASP3
UniProt IDQ005V2
Protein RefseqThe length of the protein is 277 amino acids long.
The sequence is show below: MENSENSVDAKSIKNXXXKIFHGSKSMDSGIYMDNSYKMDYPEMGLCIIINNKNFHESTXXXXRSGTDVDAANLRETFTNLKYEVRNKNDLTREQIXXXXXXXSREDHSKRSSFICVLLSHGDEGIIYGTNGPVDLKKLTGFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTEDDIACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLRLYAHKLEFMHILTRVNRKVALEFESFSLDSAFHGKKQIPCIVSMLTKELYFYH.
For Research Use Only | Not For Clinical Use.
Online Inquiry