Mouse Anti-Cattle BEST1 Antibody (MO-AB-08058R)
Cat: MO-AB-08058R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO08058R |
| Specificity | This antibody binds to Cattle BEST1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Bestrophin calcium-activated chloride channels (CaCCs) regulate the flow of chloride and other monovalent anions across cellular membranes in response to intracellular calcium (Ca(2+)) levels. Mutations in bestrophin 1 (BEST1) cause certain eye diseases. Here we present X-ray structures of chicken BEST1-Fab complexes, at 2.85 Å resolution, with permeant anions and Ca(2+). Representing, to our knowledge, the first structure of a CaCC, the eukaryotic BEST1 channel, which recapitulates CaCC function in liposomes, is formed from a pentameric assembly of subunits. Ca(2+) binds to the channel''s large cytosolic region. A single ion pore, approximately 95 Å in length, is located along the central axis and contains at least 15 binding sites for anions. A hydrophobic neck within the pore probably forms the gate. Phenylalanine residues within it may coordinate permeating anions via anion-π interactions. Conformational changes observed near the ''Ca(2+) clasp'' hint at the mechanism of Ca(2+)-dependent gating. Disease-causing mutations are prevalent within the gating apparatus. |
| Product Overview | Mouse Anti-Cattle BEST1 Antibody is a mouse antibody against BEST1. It can be used for BEST1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Bestrophin 1; BEST1 |
| UniProt ID | A1A4I7 |
| Protein Refseq | The length of the protein is 589 amino acids long. The sequence is show below: MTVTYSSQVANARLGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRMALTDEQQVIFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMNLVSSFVEGKDEQGRMLRRTLMRYANLGNVLILRSVSAAVYKRFPSPQHLVKAGFMTPSEHKHLQKLSLPHNSFWMPWVWFANLSTKAWIGGRIRDPILLQSLLNEMNTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGR. |
See other products for " BEST1 "
| MORAB-027F | Anti-BEST1 Antibody (Cat MORAB-027F), Mouse IgG |
| CBMOAB-00900HCB | Mouse Anti-C. elegans BEST1 Antibody (CBMOAB-00900HCB) |
| CBMOAB-67627FYA | Mouse Anti-Zebrafish best1 Antibody (CBMOAB-67627FYA) |
| MO-AB-51847W | Mouse Anti-Marmoset BEST1 Antibody (MO-AB-51847W) |
| MO-AB-01288W | Mouse Anti-Rhesus BEST1 Antibody (MO-AB-01288W) |
| MO-AB-24121R | Mouse Anti-Pig BEST1 Antibody (MO-AB-24121R) |
| CBMOAB-02375FYA | Mouse Anti-D. melanogaster Best1 Antibody (CBMOAB-02375FYA) |
| MO-AB-29237W | Mouse Anti-Dog BEST1 Antibody (MO-AB-29237W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry