Mouse Anti-Pig BEST1 Antibody (MO-AB-24121R)


Cat: MO-AB-24121R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24121R
SpecificityThis antibody binds to Pig BEST1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the bestrophin gene family. This small gene family is characterized by proteins with a highly conserved N-terminus with four to six transmembrane domains. Bestrophins may form chloride ion channels or may regulate voltage-gated L-type calcium-ion channels. Bestrophins are generally believed to form calcium-activated chloride-ion channels in epithelial cells but they have also been shown to be highly permeable to bicarbonate ion transport in retinal tissue. Mutations in this gene are responsible for juvenile-onset vitelliform macular dystrophy (VMD2), also known as Best macular dystrophy, in addition to adult-onset vitelliform macular dystrophy (AVMD) and other retinopathies. Alternative splicing results in multiple variants encoding distinct isoforms. Forms calcium-sensitive chloride channels. Permeable to bicarbonate.
Product OverviewThis product is a mouse antibody against BEST1. It can be used for BEST1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBestrophin-1; BEST1
UniProt IDI3LNI9
Protein RefseqThe length of the protein is 585 amino acids long.
The sequence is show below: MTVTYSSQVANARLGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRMALTDEQQVIFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMNLVSCFVEGKDEQGRLLRRTLMRYANLGNVLILRSISAAVYKRFPSPQHLVKAGFMTPSEHKHLEKLSLPHNSFWMPWVWFANLSTKAWIGGRIRDPVLLQSLLDEMNTLRTQCGHLYAYDWISVPLVYTQVVTVAVYSFFLACLVGRQFLNPAKAYPGHEMDLVVPLFTFLQFFFYAGWLKVAEQLINPFGEDDDDFETNWIVDRSLQVSLLAVDEMHQDLPPMERDMYWNDPEPHPPYTAASAQSRRPSFFGSTFNISLGKEDMEFQPEEEEEAHTGILGHFLGLQSSDHQPPRTNSKTKLLWPKKEGHFHEGHPKNLRGARLDSSDQEDSKAWREGGFKSAALCGRPGYHSAPQTPLGHTPMVFPPEESAPLGLRRVSGIDEAAKDQSLQPATPSIKKSFELLPESAEASAEPLQGSHVRRKTVEFNLADLSEAPEHLKEPNLEPPMGIHAILKDHRDPYWALENRSVLSLNPGH.
For Research Use Only | Not For Clinical Use.
Online Inquiry