Mouse Anti-Zebrafish tardbp Antibody (CBMOAB-08627FYB)


Cat: CBMOAB-08627FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO08627FYB
SpecificityThis antibody binds to Zebrafish tardbp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Product OverviewMouse Anti-Zebrafish tardbp Antibody is a mouse antibody against tardbp. It can be used for tardbp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTAR DNA binding protein; tardb
UniProt IDQ802C7
Protein RefseqThe length of the protein is 412 amino acids long.
The sequence is show below: MAEMYIRVAEEENEEPMEIPSEDDGTVLLSTVSAQFPGACGLRFRSPVSQCMRGVRLVDGILHAPENGWGNLVYVVNYPKETVLPDNKRKMDEIDASSATKIKRGDQKTSDLIVLGLPWKTSEQDLKDYFGTFGEVIMVQVKRDVKTGNSKGFGFVRFGDWETQSKVMTQRHMIDGRWCDCKLPNSKQGIDEPMRSRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAAALCGEDLIIKGVSVHISNAEPKHNNTRQMMERAGRFGNGFGGQGFAGSRSNMGGGGGGSSSSLGNFGNFNLNPAMMAAAQAALQSSWGMMGMLAQQNQSGTSGTSTSGTSSSRDQAQTYSSANSNYGSSSAALGWGTGSNSGAASAGFNSSFGSSMESKSSGWGM.
For Research Use Only | Not For Clinical Use.
Online Inquiry